Research peptides · Specialized research compounds
IGF1-LR3
Available documentary data and items still to verify are detailed below.
Price incl. VAT€115.00
AvailabilityAvailable
SKUIGF1-LR3
Loading availability…
02 — Information to verify
Product details
Overview
IGF-1 LR3, or Long-[Arg3]-IGF-I, is an 83-amino-acid IGF-1 analogue. It contains a 13-residue N-terminal extension and a Glu3→Arg substitution in the IGF-1 portion. Research uses include growth-factor studies in cell-culture systems.
Structure and technical data
Technical data
Catalog format: 1 mg. The sequence is verified against BMRB entry 4494. The listed formula is calculated for the chain with three disulfide bonds; the fully reduced chain contains six additional hydrogen atoms. Reference CAS: 143045-27-6; UNII: M9L22Y19H9.
Structure not available.
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Molecular formula
- C400H619N111O115S9
- Reported molecular mass
- 9111.6 g/mol
- CAS number
- 143045-27-6
- PubChem CID
- Not documented
- Reported synonyms
- IGF-1 LR3; Long-[Arg3]-IGF-I; Long R3 IGF-I
- UNII
- M9L22Y19H9
- PubChem SID
- 381123731
- BMRB
- 4494
Reference molecular data.
Formula and theoretical average mass calculated from the 83-residue BMRB sequence with three disulfide bonds, free termini, and no counterions. The reduced chain has formula C400H625N111O115S9 and theoretical average mass 9117.6 g/mol. The PubChem reference is a substance SID, not a CID.
Research context
The modifications are studied for their effects on IGFBP binding and IGF-1-receptor signalling. The NMR structure describes molecular folding. The literature also includes physiological studies in sheep models.
Analogue engineering and IGFBP bindingReceptor signalling, proliferation, and cell cultureInsulin secretion: acute and prolonged exposureFollicular angiogenesis and progesteroneGrowth, muscle, and distinguishing variants
Analogue engineering and IGFBP binding
The MFPAMPLSSLFVN extension precedes the 70-residue modified IGF-1 portion. Arg3 numbering refers to that portion, not the entire 83-residue chain. The modifications were developed to alter interaction with IGF-binding proteins while retaining investigation of IGF-1-receptor responses.
Receptor signalling, proliferation, and cell culture
IGF-1R activation connects with PI3K/AKT and MAPK pathways involved in survival, growth, and metabolic responses. Culture studies distinguish viability, cell number, and protein production. Results obtained with native IGF-1 are not automatically experimental findings for the LR3 variant.
Insulin secretion: acute and prolonged exposure
The 2023 study compares fetal-sheep insulin secretion with isolated-islet responses after acute LR3 exposure. The in-vivo decrease does not persist in the same way in isolated islets. Comparison with prolonged-exposure studies shows why duration and experimental environment change interpretation.
Follicular angiogenesis and progesterone
In bovine follicular cultures, LR3-IGF1 has limited effects on endothelial-network growth and a small effect on proliferation. Receptor blockade with picropodophyllin markedly reduces networks and progesterone. This highlights receptor-system involvement without showing that adding LR3 produces a strong angiogenic effect.
Growth, muscle, and distinguishing variants
The bibliography includes fetal growth, nutrient availability, muscle, and IGF-axis genetics. Some studies use sheep recombinant IGF-1 or exercise, others LR3. Genetic data in athletes describe associations; they do not demonstrate benefits from peptide administration or equivalence among IGF forms.
10.3389/fphys.2022.954948 10.1519/JSC.0000000000004102 10.1152/ajpcell.00344.2021
References
- New insights on the cardiovascular effects of IGF-1
- Insulin-like Growth Factor and its Therapeutic Potential
- Attenuated glucose-stimulated insulin secretion during an acute IGF-1 LR3 infusion into fetal sheep does not persist in isolated islets
- Long-(Arg3)-insulin-like growth factor-I — PubChem substance record (CAS 143045-27-6; UNII M9L22Y19H9)
- Long-[Arg3]-IGF-I — BMRB 4494, 83-residue sequence
- Solution structure and backbone dynamics of long-[Arg(3)]insulin-like growth factor-I
- Sheep recombinant IGF-1 promotes organ-specific growth in fetal sheep
- Novel Demonstration of a Physiologic/Pharmacologic Role of Insulin-Like Growth Factor-1 in Ovulation in Rats and Action on Cumulus Oophorus
- IGF-1 inhibits inflammation and accelerates angiogenesis via Ras/PI3K/IKK/NF-κB signaling pathways to promote wound healing
- Reduced glucose-stimulated insulin secretion following a 1-wk IGF-1 infusion in late gestation fetal sheep is due to an intrinsic islet defect
- Effect of insulin-like growth factor system on luteinising angiogenesis
- Insulin-like Growth Factor Axis Genetic Score and Sports Excellence
- Aerobic exercise and resistance exercise alleviate skeletal muscle atrophy through IGF-1/IGF-1R-PI3K/Akt pathway in mice with myocardial infarction
Catalog of products presented for research activities. Not for human or veterinary use. This notice does not replace verification of applicable rules.